Protein Info for MPMX26_01929 in Acinetobacter radioresistens SK82

Annotation: Riboflavin transporter RfnT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 370 to 387 (18 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 228 (204 residues), 43.1 bits, see alignment E=1.3e-15 amino acids 217 to 386 (170 residues), 55.4 bits, see alignment E=2.6e-19

Best Hits

KEGG orthology group: None (inferred from 86% identity to abn:AB57_1652)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>MPMX26_01929 Riboflavin transporter RfnT (Acinetobacter radioresistens SK82)
MLQNTMHRQVFILASSQSLFQTISVMVMTIGGLAGANIANTPTLATLPIASMFLGTAMMM
FPASMWMAKVGRRNGFLCGAFLGISGGIIAAVGIIYSSLYLLALGTFCVGAYQSFAQFYR
FAASEVADDTFRSRAISFVMAGGVVAALIGPVLARFGGPLFNHLEYVGSFLIITIVSLIA
MGILSRLHIPDQVEIKTSFSAGRPWLKIVFQPMYLVALLGAITGYGIMILGMTATPIAMR
HAHHELGTITTVIQLHVLGMFLPSFFTGNLIVRFGVLKVMFAGLLLFACYIAFALSGLQF
HSFAISLVLLGVGWNFLFIGSTSLLTRTYTHEEKAKAQAINDMTVFVVGLICSFSAGALL
DIIGWKVMNMALIPWLVITALSLVWLSKKTQND