Protein Info for MPMX26_01918 in Acinetobacter radioresistens SK82

Annotation: Homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 64 (26 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details PF01810: LysE" amino acids 15 to 199 (185 residues), 107.9 bits, see alignment E=2.4e-35

Best Hits

KEGG orthology group: None (inferred from 59% identity to abb:ABBFA_000850)

Predicted SEED Role

"LysE-family efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>MPMX26_01918 Homoserine/homoserine lactone efflux protein (Acinetobacter radioresistens SK82)
MAELLIPFFIAIILLTITPGLDTALIIRTATVGNKSKAFNAALGIACGCLAWGVLVACGI
GAILATSELAFNLLKWLGAVYLVWLGIGLIFKPRTAFEITSNPNKQENWFLKGLITNILN
PKVGFFYVSFLPQFIPTGENSTYWLLSLVAIHVGLGILWSLFLITLMKPISRFLQQGKTL
KKIDQITGSIFILFALKLTFTNR