Protein Info for MPMX26_01908 in Acinetobacter radioresistens SK82

Annotation: Malonyl CoA-acyl carrier protein transacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 55 to 73 (19 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details PF00698: Acyl_transf_1" amino acids 4 to 306 (303 residues), 91.5 bits, see alignment E=3.7e-30 TIGR03131: malonate decarboxylase, epsilon subunit" amino acids 4 to 302 (299 residues), 343.7 bits, see alignment E=5.1e-107

Best Hits

KEGG orthology group: K13935, malonate decarboxylase epsilon subunit [EC: 2.3.1.39] (inferred from 66% identity to aci:ACIAD1759)

Predicted SEED Role

"Malonyl CoA acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Malonate decarboxylase (EC 2.3.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.39

Use Curated BLAST to search for 2.3.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>MPMX26_01908 Malonyl CoA-acyl carrier protein transacylase (Acinetobacter radioresistens SK82)
MNSIWVYPGQGAQKINMLHELPIHKLVKQYLEQASDVLKQDVLLLDQPENLRSNYAVQLC
LYLSGIISSALLTEQNIYPDYVAGLSIGAWAAATVAGVISFEDGLKLVARRGELMQQAYP
QGYGMTAVIGTDRMRVEQWISQVRIKTPDIYIANINASNQIVISGSEEAMQQVSSLARLD
GAIVKRLAVSVPSHCILLEPQARQLYIDIKGVASAQPKIKYLSGTSARLLRTDVQILDDL
TFNMSRMIDWESTVQAAWERGVRLHIEALPGTVLTGLARKIFKEGSVLCFQNTQLDSLIT
AMQKEQVS