Protein Info for MPMX26_01894 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF00355: Rieske" amino acids 22 to 112 (91 residues), 66.3 bits, see alignment E=1.9e-22 PF19112: VanA_C" amino acids 159 to 331 (173 residues), 43.6 bits, see alignment E=3.8e-15

Best Hits

KEGG orthology group: None (inferred from 98% identity to aby:ABAYE2846)

Predicted SEED Role

"GbcA Glycine betaine demethylase subunit A" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>MPMX26_01894 hypothetical protein (Acinetobacter radioresistens SK82)
MNAIVSTSQSAEEYLELGLRDQWHPVLASWEVAANPVGITRLGENIVVWRDAEGQVHALE
DRCPHRGARLSLGWNLGDRVACWYHGVEVRADGVVADVPAVHECPMTGTKCLKNYPVIEQ
HGAIFIWFGIDANEQPAPLEFPEQLASEEWSSFLCQADWKVNHQYAIDNVMDPMHGTYLH
ATSHSMADGERTAEMKHRTTDNGFVFEKEGQTGVNFDWVEYGSTGASWLRLSIPYRKQFG
PGGEFWIVGYATPIDANNTRVFFWRCRKVSCWQRNVWRFLYRNHLEQLHWDVLEQDRIIL
ENLAPNAREKEFLYQHDVGLARLRRLMKKEAEKQLKKIAALNASNRIEMQEEAHG