Protein Info for MPMX26_01810 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 TIGR01537: phage portal protein, HK97 family" amino acids 43 to 384 (342 residues), 287.1 bits, see alignment E=9.3e-90 PF04860: Phage_portal" amino acids 52 to 381 (330 residues), 322.3 bits, see alignment E=1.7e-100

Best Hits

KEGG orthology group: None (inferred from 57% identity to aap:NT05HA_0495)

Predicted SEED Role

"Phage portal protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>MPMX26_01810 hypothetical protein (Acinetobacter radioresistens SK82)
MSDLQDTGFWSRFWSRLTGRTQLKKGDTSYPTDSYMSAGGAVVNPETALKLSAVWACVKL
RAETISTLPLHLYDSNKQIAKEHELYRILHDSPNADMCASEFWQIQSACLDLWGNAYSYI
SRRSNKSIISLEPLFPSDMVVKRTKEGALEYHYTENGKVKIYREDEILHFKGFTLDGYVG
LSAIQFFAQTIGMQFDANNQAQDWFKNGLKVGGFLESGETTLTKEQRQSLRENLSMFSRP
ENAGKYMVLEAGMKVSSASSIRINPVDAQLLESRYFGIEEICRAFGVPPQLIGHTNKASS
WASSLEQTNQGFLTYSLNPQLVRYEQTIARKLLLPQDKYKYRPKFSVDGLLRANNTARAD
FYVKMTQNGLFTRNEVRELEDMPRADDPTADKLMVQMQMVPLGTEKGEKNE