Protein Info for MPMX26_01785 in Acinetobacter radioresistens SK82

Annotation: Biotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00433: biotin synthase
  • amino acids 18 to 314 (297 residues), 409 bits, E=5.6e-127
• PF04055: Radical_SAM
  • amino acids 52 to 212 (161 residues), 86.1 bits, E=3.2e-28
• PF06968: BATS
  • amino acids 224 to 314 (91 residues), 94.8 bits, E=3e-31

Best Hits

Swiss-Prot: 91% identical to BIOB_ACICA: Biotin synthase (bioB) from Acinetobacter calcoaceticus

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 89% identity to aby:ABAYE2129)

MetaCyc: 63% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

• biotin biosynthesis I (13/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
• biotin biosynthesis II (4/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Protein Sequence (333 amino acids)

>MPMX26_01785 Biotin synthase (Acinetobacter radioresistens SK82)
MSSTRPVRNDWSREEIEALYQQPFLDLIFEAQRIHRENFQPNTIQVSTLLSIKTGKCPED
CKYCSQSAHYDSNLEAEKRIAVEKVIREAKEALESGSSRFCMGAAWRNPNERDMPYVLEM
VREVKALGLETCMTLGMLNQSQAERLKDAGLDYYNHNLDTSREYYSHIISTRTFDDRLDT
LDHVRQAGMKVCSGGIVGLGESKQDRIGLLHELATLPVHPESVPINMLVPIEGTPLADVE
KLDVTEWIRTIAVARIIMPQSYIRLSAGRESLSDSDQALAFMAGANSLFSGEKLLTTPNA
GEGKDRILFNKLGLSAEKAKPTVAELSIDAMSA