Protein Info for MPMX26_01764 in Acinetobacter radioresistens SK82

Annotation: ATP-dependent RecD-like DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 PF13604: AAA_30" amino acids 7 to 210 (204 residues), 60.2 bits, see alignment E=9.4e-20 PF13245: AAA_19" amino acids 7 to 151 (145 residues), 64.7 bits, see alignment E=4.2e-21 PF05970: PIF1" amino acids 13 to 189 (177 residues), 127.1 bits, see alignment E=3.3e-40 PF13401: AAA_22" amino acids 19 to 132 (114 residues), 29.8 bits, see alignment E=2.7e-10 PF14493: HTH_40" amino acids 472 to 571 (100 residues), 51.5 bits, see alignment E=4.1e-17

Best Hits

KEGG orthology group: None (inferred from 88% identity to aci:ACIAD2014)

Predicted SEED Role

"Possible helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (575 amino acids)

>MPMX26_01764 ATP-dependent RecD-like DNA helicase (Acinetobacter radioresistens SK82)
MIRVMKQETALKLMKAGENVFLTGSAGAGKTYTLNQYINYLKARKVPVAITASTGIAATH
MNGMTIHTWAGIGIKDFLSDDDLKRMKERKYLKEHLENAQVLIIDEISMLHAKQLNLVNQ
VLKYFKESDTAFGGIQVIAAGDFFQLPPVGKNDERNRDKFCFMSDAWVEAKFRVCYLTEQ
HRQDDEVLNQVLNAIRAQRIHPQHIQALKKSRQHDIGETFTRLYTHNMDVDSLNYQHLNA
IEGDEHQFEAVCDGNEKLVETLKSSVRAPENLTLKKHAKVMFVKNNFDLGYINGSLGEVI
GFEEDDEHGLLPKVKLTDDTTLLVAPETWSIENEAGKVIASFQQIPLRLAWAITIHKSQG
MTLEAAEINLSHTFEKGQGYVALSRLKSLEGLKLVGFNDQALELDSLAIKADRRFQELSQ
EAETHFADTDLTPQHKAFIRHCGGTLNETEIQRNEKKIAKAGNKPNYGSATLDETKALFE
DGYDIQDIAQERGLTVATVINHLARLHKEQGLDISVAHPGEEVVEQVRKLYKRLQKSKRS
ENFNDDGSIKLRPIVEATSPRMGYDQVRLALLFIE