Protein Info for MPMX26_01763 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02962: CHMI
  • amino acids 2 to 117 (116 residues), 72.6 bits, E=1.9e-24

Best Hits

KEGG orthology group: K01826, 5-carboxymethyl-2-hydroxymuconate isomerase [EC: 5.3.3.10] (inferred from 48% identity to acd:AOLE_06680)

Predicted SEED Role

"5-carboxymethyl-2-hydroxymuconate delta-isomerase (EC 5.3.3.10)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 5.3.3.10)

MetaCyc Pathways

• 4-hydroxyphenylacetate degradation (1/8 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Tyrosine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.10

Protein Sequence (122 amino acids)

>MPMX26_01763 hypothetical protein (Acinetobacter radioresistens SK82)
MPHVVVEYSANIEQLDRPKLLKRINQVLIESELFQPNDIKARLYCNEDFLIGEGDSSQAY
IYVEFSLFKGRTNEQKQRVREALMHVLTQQDYYKTDNDLQIQLCVQLLEMDKENYLKQIV
NC