Protein Info for MPMX26_01762 in Acinetobacter radioresistens SK82

Annotation: Hydroxyethylthiazole kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02110: HK
  • amino acids 20 to 263 (244 residues), 213.4 bits, E=1.7e-67

Best Hits

Swiss-Prot: 72% identical to THIM_ACIBS: Hydroxyethylthiazole kinase (thiM) from Acinetobacter baumannii (strain SDF)

KEGG orthology group: K00878, hydroxyethylthiazole kinase [EC: 2.7.1.50] (inferred from 72% identity to acd:AOLE_06690)

Predicted SEED Role

"Hydroxyethylthiazole kinase (EC 2.7.1.50)" in subsystem Thiamin biosynthesis (EC 2.7.1.50)

MetaCyc Pathways

• thiamine diphosphate salvage II (5/5 steps found)
• thiamine diphosphate salvage V (3/3 steps found)
• thiamine diphosphate salvage IV (yeast) (5/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (4/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.50

Protein Sequence (276 amino acids)

>MPMX26_01762 Hydroxyethylthiazole kinase (Acinetobacter radioresistens SK82)
MSFTEQKNTLLQQVIQAWTRLQEQQPLVQCITNSVATNYAANILLAAGASPAMIDNPFEA
ESFANVTSALSINLGTPTTEQMQAMLISAQTVDHKNTPWVLDPVGYGPVLKWRSSMVDQL
LAFKPSVIRGNASEISALAGKQVQAKGVDSTISSHTVYRQAQCLLVHSECIAISGEADFI
LSRELGLVIQVNGGSYLQPKVTATGCALGALIAAYSAVTTPTIAALAAHLHFAIAGKLAY
EKIASVGSFNVVFMDYIHTLNSEMLLQYADFQLISL