Protein Info for MPMX26_01751 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details PF05232: BTP" amino acids 5 to 65 (61 residues), 58.4 bits, see alignment E=3e-20 amino acids 70 to 133 (64 residues), 79.4 bits, see alignment E=7.8e-27

Best Hits

KEGG orthology group: None (inferred from 76% identity to aci:ACIAD1978)

Predicted SEED Role

"FIG00350811: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (141 amino acids)

>MPMX26_01751 hypothetical protein (Acinetobacter radioresistens SK82)
MLLSKRRLIHALSYEIILLIIIAIALSFLFEIPMEVSGTLGVVMAITSVIWNMIFNHFFE
KFEHRHQLKRTIKVRICHAVGFEGGLMLATIPMVAYALNIGLGQAILLDLGMTLCILVYT
FIFQWFYDRIEMRLGYAPDYR