Protein Info for MPMX26_01735 in Acinetobacter radioresistens SK82

Annotation: 7-methyl-GTP pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR00172: septum formation protein Maf" amino acids 4 to 190 (187 residues), 140.1 bits, see alignment E=2.9e-45 PF02545: Maf" amino acids 5 to 191 (187 residues), 158.1 bits, see alignment E=1.1e-50

Best Hits

Swiss-Prot: 69% identical to NTPP_ACIAD: Nucleoside triphosphate pyrophosphatase (ACIAD1930) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 75% identity to abb:ABBFA_001935)

MetaCyc: 47% identical to m7GTP pyrophosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-7079

Predicted SEED Role

"FIG146278: Maf/YceF/YhdE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>MPMX26_01735 7-methyl-GTP pyrophosphatase (Acinetobacter radioresistens SK82)
MKQPPLILASSSETRKALLNRLGLQYRCISPDIDELPQGETHADELARRLAFDKAHIVAR
LYPEAVVIGSDQVAWREHTPDDFIGKPLTVEKAVQQLQANSGKTVYFSTGLSVQQHSTGF
QHTLVEHYQVKFRTLNLAEIERYIELDQPLHCAGSFKCESLGISLFEKMTGNDQTTLMGL
PMIQLCQILRQLDFQIP