Protein Info for MPMX26_01720 in Acinetobacter radioresistens SK82

Annotation: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03614: pyrimidine utilization protein B
  • amino acids 18 to 241 (224 residues), 423.6 bits, E=9.2e-132
• PF00857: Isochorismatase
  • amino acids 33 to 230 (198 residues), 138.4 bits, E=1.4e-44

Best Hits

Swiss-Prot: 74% identical to RUTB_ACIAD: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K09020, putative isochorismatase family protein RutB [EC: 3.-.-.-] (inferred from 74% identity to aci:ACIAD0028)

MetaCyc: 73% identical to ureidoacrylate amidohydrolase / (+)-gamma-lactamase monomer (Escherichia coli K-12 JM109)
3.5.2.-; RXN0-6460 [EC: 3.5.1.110]

Predicted SEED Role

"Predicted amidohydrolase RutB in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

• uracil degradation III (5/5 steps found)
• L-citrulline degradation (3/3 steps found)
• urea degradation I (3/3 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• cyanate degradation (2/3 steps found)
• cyanuric acid degradation II (3/5 steps found)
• superpathway of allantoin degradation in yeast (3/6 steps found)
• cyanuric acid degradation I (2/5 steps found)
• superpathway of atrazine degradation (3/8 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.-.-.-

Use Curated BLAST to search for 3.-.-.- or 3.5.1.110

Protein Sequence (246 amino acids)

>MPMX26_01720 Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (Acinetobacter radioresistens SK82)
MNMKSAICADFTSDSAPILNAAPEAIKLDPKQTALIIVDMQNAYASSGGYLDLAGFDVST
TQPVIEQIKKAMDIAHQAGIQVIYFRNGWDQHYVEAGGAGSPNFHKSNALKTMRKQPELQ
GKLLAKGGWDYELVDELQPVTGDIVIDKPRYSGFFNTSLDSVLRARGIRNLLLTGIATNV
CVESTLRDGFFLEYFGVLLDDACYQAGPREAHEATLYNVKTFFGWVSDVASMQQCFSQKQ
SQSSAA