Protein Info for MPMX26_01719 in Acinetobacter radioresistens SK82

Annotation: Putative aminoacrylate peracid reductase RutC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03610: pyrimidine utilization protein C
  • amino acids 1 to 127 (127 residues), 241 bits, E=1.3e-76
• PF01042: Ribonuc_L-PSP
  • amino acids 14 to 125 (112 residues), 116.9 bits, E=2.8e-38

Best Hits

Swiss-Prot: 76% identical to RUTC_METRJ: Putative aminoacrylate peracid reductase RutC (rutC) from Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)

KEGG orthology group: K09021, UPF0076 protein RutC (inferred from 76% identity to ebi:EbC_15640)

MetaCyc: 71% identical to 3-aminoacrylate deaminase (Escherichia coli K-12 substr. MG1655)
RXN0-6452

Predicted SEED Role

"Bona fide RidA/YjgF/TdcF/RutC subgroup"

MetaCyc Pathways

• uracil degradation III (5/5 steps found)

Protein Sequence (127 amino acids)

>MPMX26_01719 Putative aminoacrylate peracid reductase RutC (Acinetobacter radioresistens SK82)
MAKTVIIPEGTGTPLAPYVPATLADNIVYVSGTLPLDTNNEVVFVGDAAAQTRHVLSTIQ
NVIETAGGTMDDVTFNSIFLKDWADYAAINTVYREFFPNEKPARFCIQCGLVKPEALIEI
ASVAHIG