Protein Info for MPMX26_01714 in Acinetobacter radioresistens SK82

Annotation: tRNA/tmRNA (uracil-C(5))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR02143: tRNA (uracil(54)-C(5))-methyltransferase" amino acids 4 to 360 (357 residues), 547.2 bits, see alignment E=7.8e-169 PF05958: tRNA_U5-meth_tr" amino acids 4 to 360 (357 residues), 534 bits, see alignment E=1.7e-164 PF09445: Methyltransf_15" amino acids 206 to 301 (96 residues), 22.7 bits, see alignment E=6.5e-09

Best Hits

Swiss-Prot: 80% identical to TRMA_ACIBS: tRNA/tmRNA (uracil-C(5))-methyltransferase (trmA) from Acinetobacter baumannii (strain SDF)

KEGG orthology group: K00557, tRNA (uracil-5-)-methyltransferase [EC: 2.1.1.35] (inferred from 80% identity to abm:ABSDF2113)

MetaCyc: 51% identical to tRNA m5U54 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (uracil-5-)-methyltransferase. [EC: 2.1.1.35]

Predicted SEED Role

"tRNA (Uracil54-C5-)-methyltransferase (EC 2.1.1.35)" (EC 2.1.1.35)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>MPMX26_01714 tRNA/tmRNA (uracil-C(5))-methyltransferase (Acinetobacter radioresistens SK82)
MTATYQAQLEAKIQRISTQFAEFNPPALEVFGSPEQHFRMRAEFRIWHTDQDMFYAMFER
NPEDQQKTVIRVDEFPIADHSINQLMPILLAELKADPLLEKRLFEVDFLATLSGEMLVTL
IYHRKLDNEWEKAARTLAEKLNIKIIGRSRGQKLVLTDDFVVEELQVLEQKFKYKQIEGG
FTQPNAIVCQKMLEWACKAAEASQKHLLELYCGNGNFTLPLSLKFERVLATELAKSSVYA
AQWNIEQNGIDNIQVARLSAEEFTQAFNGEREFRRLQEAEIDIQSYEFDTVFVDPPRAGI
DLDTLKLLQRFDRIIYISCNPDTLHDNLKILLESHKILKFAMFDQFPYTHHVETGILLEK
I