Protein Info for MPMX26_01712 in Acinetobacter radioresistens SK82

Annotation: 5-hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02962: hydroxyisourate hydrolase
  • amino acids 22 to 132 (111 residues), 140.1 bits, E=1.9e-45
• PF00576: Transthyretin
  • amino acids 24 to 132 (109 residues), 130.2 bits, E=4.8e-42
• PF24695: PITM1-3
  • amino acids 37 to 84 (48 residues), 28.3 bits, E=1.7e-10

Best Hits

Swiss-Prot: 51% identical to HIUH_ECOLI: 5-hydroxyisourate hydrolase (hiuH) from Escherichia coli (strain K12)

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 68% identity to acd:AOLE_06010)

MetaCyc: 51% identical to hydroxyisourate hydrolase / transthyretin-related protein (Escherichia coli K-12 substr. MG1655)
Hydroxyisourate hydrolase. [EC: 3.5.2.17]

Predicted SEED Role

"Transthyretin family protein"

MetaCyc Pathways

• ureide biosynthesis (4/7 steps found)
• urate conversion to allantoin I (1/3 steps found)
• urate conversion to allantoin II (1/3 steps found)
• urate conversion to allantoin III (1/3 steps found)
• superpathway of purines degradation in plants (6/18 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.17

Protein Sequence (133 amino acids)

>MPMX26_01712 5-hydroxyisourate hydrolase (Acinetobacter radioresistens SK82)
MKKLIIAGLSLCAAQFSFAAANPLSVHVLNLETGLPSSNVEVTLEEQIKGKWVQISQSKT
NENGRITALYPENKNFHQGLYKVTFKTGDWFKTQKQDTFFPEIPVIFEVKGTVPHYHIPL
LLSPYGYSTYRGN