Protein Info for MPMX26_01699 in Acinetobacter radioresistens SK82

Annotation: 3-oxoadipate CoA-transferase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 TIGR02429: 3-oxoacid CoA-transferase, A subunit" amino acids 1 to 220 (220 residues), 384.9 bits, see alignment E=4.7e-120 PF01144: CoA_trans" amino acids 7 to 218 (212 residues), 221.6 bits, see alignment E=4e-70

Best Hits

Swiss-Prot: 85% identical to PCAI_ACIAD: 3-oxoadipate CoA-transferase subunit A (pcaI) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01031, 3-oxoadipate CoA-transferase, alpha subunit [EC: 2.8.3.6] (inferred from 85% identity to aby:ABAYE1717)

MetaCyc: 69% identical to alpha subunit of beta-ketoadipate succinyl-CoA transferase (Pseudomonas putida)
3-oxoadipate CoA-transferase. [EC: 2.8.3.6]

Predicted SEED Role

"3-oxoadipate CoA-transferase subunit A (EC 2.8.3.6)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 2.8.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.6

Use Curated BLAST to search for 2.8.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>MPMX26_01699 3-oxoadipate CoA-transferase subunit A (Acinetobacter radioresistens SK82)
MIDKSRTSLAEVLSQIKDSSTIMIGGFGTAGQPAELIDGLIELGVQDLVIVNNNAGNGDY
GLAKLLKSGAVRKIICSFPRQSDSWVFDELYRAGKIELELVPQGNLACRIQAAGMGLGPI
YTPTGFGTLLAEGKPTLHHEGKDYVLENPIRADFALIKAHQGDRWGNLVYRKSARNFGPI
MAMAAEVTIAQVSEVVELGALDPEHIVTPGIFVQHVVAVTPSSPNTHA