Protein Info for MPMX26_01696 in Acinetobacter radioresistens SK82

Annotation: Benzoate 1,2-dioxygenase electron transfer component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 11 to 88 (78 residues), 65.5 bits, E=5.2e-22
• PF00970: FAD_binding_6
  • amino acids 112 to 204 (93 residues), 58.7 bits, E=9.6e-20
• PF00175: NAD_binding_1
  • amino acids 215 to 317 (103 residues), 70.4 bits, E=3e-23

Best Hits

Swiss-Prot: 83% identical to BENC_ACIAD: Benzoate 1,2-dioxygenase electron transfer component (benC) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05784, benzoate 1,2-dioxygenase electron transfer component (inferred from 91% identity to abb:ABBFA_002366)

MetaCyc: 54% identical to XylZ (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]

Predicted SEED Role

"benzoate dioxygenase, ferredoxin reductase component" in subsystem Benzoate degradation

MetaCyc Pathways

• benzoate degradation I (aerobic) (2/2 steps found)
• mandelate degradation to acetyl-CoA (11/18 steps found)
• meta cleavage pathway of aromatic compounds (5/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (5/13 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (14/35 steps found)
• superpathway of aerobic toluene degradation (9/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (9/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Protein Sequence (338 amino acids)

>MPMX26_01696 Benzoate 1,2-dioxygenase electron transfer component (Acinetobacter radioresistens SK82)
MSNHNVALQFEDGVTRFISVAQGETLSDAAYRQKINIPLDCRDGACGTCRAFCESGSYDM
PEENYIEDALTPEEAEEGYILACQCRPTSDAVFQIQASSDVCKTEIHKFQGTLSRVENLS
DSTITFDIKLDEGQPDIHFLAGQYVNVEIPGTTETRSYSFSSKPGNRLTGFVVRNVPNGK
MSEFLSKTVKPGDKMSFTGPFGSFYLRHINRPVLMLAGGTGIAPFMSMLQVLEEKGCEQP
VRLVFGVTNDFDLVALEKLDELQEKFPWFEYCTVVANPESLHERKGYVTNHIDHGWLNSG
DVDIYLCGPVPMVEAVRGWLDAEGVKPANFLFEKFSAN