Protein Info for MPMX26_01693 in Acinetobacter radioresistens SK82

Annotation: Catechol 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR02439: catechol 1,2-dioxygenase" amino acids 2 to 287 (286 residues), 491.6 bits, see alignment E=2.8e-152 PF04444: Dioxygenase_N" amino acids 23 to 92 (70 residues), 74.7 bits, see alignment E=4.1e-25 PF00775: Dioxygenase_C" amino acids 101 to 286 (186 residues), 206.5 bits, see alignment E=2.5e-65

Best Hits

Swiss-Prot: 83% identical to CATA_ACIGI: Catechol 1,2-dioxygenase (catA) from Acinetobacter guillouiae

KEGG orthology group: K03381, catechol 1,2-dioxygenase [EC: 1.13.11.1] (inferred from 92% identity to abm:ABSDF1996)

MetaCyc: 53% identical to catechol-1,2-dioxygenase (Pseudomonas reinekei)
Catechol 1,2-dioxygenase. [EC: 1.13.11.1]

Predicted SEED Role

"Catechol 1,2-dioxygenase (EC 1.13.11.1)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 1.13.11.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.1

Use Curated BLAST to search for 1.13.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>MPMX26_01693 Catechol 1,2-dioxygenase (Acinetobacter radioresistens SK82)
MNRQQIDALVKQMNVDTAKGPVDERIQQVVVRLLGDLFQAIEDLDIQPSEVWKGLEYLTD
AGQANELGLLAAGLGLEHYLDLRADEADAKAGITGGTPRTIEGPLYVAGAPESVGFARMD
DGSESDKVDTLIIEGTVTDTQGNIIEGAKVEVWHANSLGNYSFFDKSQSDFNLRRTILTD
ADGKYVALTTMPVGYGCPPEGTTQALLNKLGRHGNRPSHVHYFVSAPGYRKLTTQFNIEG
DEYLWDDFAFATRDGLVATATDVTDEAEIARRELDKPFKHITFNVELVKEADTAPSSEVE
RRRASA