Protein Info for MPMX26_01692 in Acinetobacter radioresistens SK82

Annotation: Muconolactone Delta-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02426: MIase
  • amino acids 1 to 89 (89 residues), 138.8 bits, E=2.6e-45
• TIGR03221: muconolactone delta-isomerase
  • amino acids 2 to 91 (90 residues), 160.7 bits, E=3.6e-52

Best Hits

Swiss-Prot: 84% identical to CATC_ACIAD: Muconolactone Delta-isomerase (catC) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K03464, muconolactone D-isomerase [EC: 5.3.3.4] (inferred from 92% identity to abn:AB57_2180)

MetaCyc: 56% identical to muconolactone isomerase monomer (Cupriavidus pinatubonensis JMP134)
5.5.1.-; 5.5.1.-; Muconolactone Delta-isomerase. [EC: 5.3.3.4]

Predicted SEED Role

"Muconolactone isomerase (EC 5.3.3.4)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 5.3.3.4)

MetaCyc Pathways

• superpathway of salicylate degradation (7/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• aromatic compounds degradation via β-ketoadipate (7/9 steps found)
• 4-methylcatechol degradation (ortho cleavage) (5/7 steps found)
• 3-chlorocatechol degradation II (ortho) (2/5 steps found)
• mandelate degradation to acetyl-CoA (11/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (14/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 5.3.3.4

Use Curated BLAST to search for 5.3.3.4

Protein Sequence (96 amino acids)

>MPMX26_01692 Muconolactone Delta-isomerase (Acinetobacter radioresistens SK82)
MLFHVRMDVHIPLDMPSEKANEIKAVEKAYSQELQRQGKWRHIWRITGQYSNISIFDVEN
NEELHNILQGLPLYPYMNIEIMALNRHPSSVRENDS