Protein Info for MPMX26_01690 in Acinetobacter radioresistens SK82

Annotation: HTH-type transcriptional regulator BenM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 91 to 112 (22 residues), see Phobius details PF00126: HTH_1" amino acids 3 to 62 (60 residues), 86.8 bits, see alignment E=7.8e-29 PF03466: LysR_substrate" amino acids 89 to 288 (200 residues), 129.4 bits, see alignment E=1.2e-41

Best Hits

Swiss-Prot: 66% identical to BENM_ACIAD: HTH-type transcriptional regulator BenM (benM) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 80% identity to abm:ABSDF1498)

Predicted SEED Role

"Aromatic hydrocarbon utilization transcriptional regulator CatR (LysR family)" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>MPMX26_01690 HTH-type transcriptional regulator BenM (Acinetobacter radioresistens SK82)
MELRHLRYFVAVVEEQSFTKAAEKLFIAQPPLSRQIQNLESELGIQLFERGSRPLQTTSA
GQFFYQHAVKLLSNAEEVKSMTKRIGLVERSITMGFVGSLLFGLLPRIIYLYRQQHPHLN
IQLVEMSTRDQIQALKEGRIDVGFGRLRISDPAVHRILLREERLMVAAHSSHPIAQHIEG
IYLADIVDEDLFCYPNTAKPNFSTQITTLFSEHGLEPRNIKEVREIQLALGLVAAGEGIC
IIPESANTIRFPHLNYVPLLDEAAKSPIFLTIRNMDETENIRSLFDCIYQVYDLEAIKYD
RALF