Protein Info for MPMX26_01673 in Acinetobacter radioresistens SK82

Annotation: Phospho-2-dehydro-3-deoxyheptonate aldolase, Tyr-sensitive

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00034: 3-deoxy-7-phosphoheptulonate synthase" amino acids 16 to 357 (342 residues), 500.4 bits, see alignment E=1e-154 PF00793: DAHP_synth_1" amino acids 54 to 348 (295 residues), 288 bits, see alignment E=2.7e-90

Best Hits

Swiss-Prot: 55% identical to AROF_SALTY: Phospho-2-dehydro-3-deoxyheptonate aldolase, Tyr-sensitive (aroF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01626, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 89% identity to aci:ACIAD2330)

MetaCyc: 55% identical to 3-deoxy-7-phosphoheptulonate synthase, Tyr-sensitive (Escherichia coli K-12 substr. MG1655)
3-deoxy-7-phosphoheptulonate synthase. [EC: 2.5.1.54]

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase I alpha (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.54

Use Curated BLAST to search for 2.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>MPMX26_01673 Phospho-2-dehydro-3-deoxyheptonate aldolase, Tyr-sensitive (Acinetobacter radioresistens SK82)
MNTLQSKTVSPSDISDVNVKSIQPLVTPATLKEELPLSETAYQTVMKGRETIRNILDGID
KRLFVVIGPCSIHDTVAAHEYADRLKVLSEKVQDTLYIVMRVYFEKPRTTVGWKGLINDP
DMDDSFNIEKGLRIGRQLLLELNEKGLPCATEALDPNSPQYYQDLISWSAIGARTTESQT
HREMSSGLSSPVGFKNGTDGGLTVATNAMQSVKHGHSFLGLNENGQVSIIRTAGNAYAHV
VLRGGNGKPNYDAGAVADAEMTLAKAKVSNKIMIDASHANSNKDPYLQPLVLKNVTEQII
DGNKSIVGVMVESHLKGGRQDIPAKLDDLEYGKSVTDGCIDWETTEKTLLAMHEALKDVL
PNR