Protein Info for MPMX26_01645 in Acinetobacter radioresistens SK82

Annotation: O-succinylhomoserine sulfhydrylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 83 to 100 (18 residues), see Phobius details PF01053: Cys_Met_Meta_PP" amino acids 12 to 392 (381 residues), 472 bits, see alignment E=2.1e-145 TIGR01325: O-succinylhomoserine sulfhydrylase" amino acids 12 to 392 (381 residues), 595.5 bits, see alignment E=1.6e-183 PF00155: Aminotran_1_2" amino acids 61 to 197 (137 residues), 41.8 bits, see alignment E=1.7e-14 PF01041: DegT_DnrJ_EryC1" amino acids 64 to 187 (124 residues), 32 bits, see alignment E=1.7e-11 PF00266: Aminotran_5" amino acids 82 to 216 (135 residues), 35.2 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 64% identical to METZ_PSEAE: O-succinylhomoserine sulfhydrylase (metZ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10764, O-succinylhomoserine sulfhydrylase [EC: 2.5.1.-] (inferred from 86% identity to abc:ACICU_01716)

MetaCyc: 64% identical to O-succinyl-L-homoserine sulfhydrylase (Pseudomonas aeruginosa PAO1)
Cystathionine gamma-synthase. [EC: 2.5.1.48]

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 2.5.1.48, 2.5.1.49

Use Curated BLAST to search for 2.5.1.- or 2.5.1.48 or 2.5.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>MPMX26_01645 O-succinylhomoserine sulfhydrylase (Acinetobacter radioresistens SK82)
MNQPDELDYQIDTLAIRTGHTRSFEGEHGEPIFLTSSFVYANAEEAAAKFSGQIPGNIYS
RFTNPTVSMFEKRLAALEGAERAVATSSGMAAILAVVMSYLKAGDHVICSRAVFGSTVSL
FEKYVAKFAVTVDFVDLTDTSAWKAALRPETRLLFVESPSNPLAEIADIQSLADIAHSNG
ALLAIDNSFCTPVLQQPLKFGADLVIYSATKYLDGQGRALGGAVVGGHQLLEDVFGMVRT
LGPSMSPFNAWIFLKGLETLNLRMKAHTASAQKLAEWLKQHPKVEKVYYAGLPEHIGHEL
AAKQQSGFGGIVSFEVKKGREGAWKVIDQTQFISITGNLGDTKSTITHPATTTHGKLSAE
AKEAAGIREGLIRVSVGLEDIDDIIRDLSRGLDLI