Protein Info for MPMX26_01630 in Acinetobacter radioresistens SK82

Annotation: putative zinc protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00675: Peptidase_M16
  • amino acids 58 to 203 (146 residues), 81.9 bits, E=4.7e-27
• PF05193: Peptidase_M16_C
  • amino acids 212 to 394 (183 residues), 115.5 bits, E=2.8e-37

Best Hits

KEGG orthology group: K01423, [EC: 3.4.-.-] (inferred from 73% identity to aci:ACIAD2298)

Predicted SEED Role

"FIG015547: peptidase, M16 family"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (467 amino acids)

>MPMX26_01630 putative zinc protease (Acinetobacter radioresistens SK82)
MSQVTRQFKKHLKSISPFLFISLSIMAGTVVISTTLQAQTTTELSRTTVETSLSNGLKVI
IREDHRSPVVMTQIWYGVGSSDESGNLLGISHALEHMMFKGTTKVPHNEFTRLSRIYGGS
VNASTFTNYTNYYQLYPKSYLPLALELEADRMTNLVLKQEDFEPEIKVIMEERRLRTDDN
PRTLAFERFKWITYPTSHYRQPVIGYMKNLQNIQLNDLKNWYHSWYTPNNAILIIVGDVN
VEATLKQVEKYFGSIPARKTPERNDVIEFDRPGYRHMELSLPVQINNLYMAWNVRSLKTA
KNPQDAYALTIIQSLLDGSISSRLQNRLVRDKKILTAVSASYDPYNRGDTLFNITALPAD
GVSFQEAQEAIQKELDQLKTEAVNSNELERVITQFVSSLIYSQDDIAGQAKMIGNLEING
LSYRLLDKLPQHYETVTPQDIQRVANAYFVRENLSTLYLSPLPQDSK