Protein Info for MPMX26_01629 in Acinetobacter radioresistens SK82

Annotation: Signal recognition particle receptor FtsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF02881: SRP54_N" amino acids 80 to 143 (64 residues), 45.7 bits, see alignment E=1.2e-15 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 91 to 362 (272 residues), 360 bits, see alignment E=4.1e-112 PF06414: Zeta_toxin" amino acids 158 to 269 (112 residues), 28.7 bits, see alignment E=1.8e-10 PF00448: SRP54" amino acids 162 to 362 (201 residues), 258.2 bits, see alignment E=9.6e-81

Best Hits

Swiss-Prot: 52% identical to FTSY_BUCAI: Signal recognition particle receptor FtsY (ftsY) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 89% identity to aci:ACIAD2296)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>MPMX26_01629 Signal recognition particle receptor FtsY (Acinetobacter radioresistens SK82)
MQQQSNVQNKFLIDSDIGDDDVTLPSLPAVDVPIIDTPKQEQPVTASIQSVEADEEKSKG
SFFSRMKQGLTKTRKNLADGMVNILIGGKEIDDELLEEVEEQLLVADIGVEATKTIINNL
TERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKNPYVILVVGVNGVGKTTTIG
KLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDVQVVAQGHGADSASVIFDAFESA
RAKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQV
QMFDEAVGLTGLTITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKAFVAA
LFETDK