Protein Info for MPMX26_01613 in Acinetobacter radioresistens SK82

Annotation: Bifunctional adenosylcobalamin biosynthesis protein CobP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to COBP_PSEAE: Bifunctional adenosylcobalamin biosynthesis protein CobP (cobP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02231, adenosylcobinamide kinase / adenosylcobinamide-phosphate guanylyltransferase [EC: 2.7.1.156 2.7.7.62] (inferred from 67% identity to abn:AB57_1884)

Predicted SEED Role

"Adenosylcobinamide-phosphate guanylyltransferase (EC 2.7.7.62)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.7.7.62)

MetaCyc Pathways

superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
superpathway of adenosylcobalamin salvage from cobinamide II (7/9 steps found)
adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (4/6 steps found)
adenosylcobinamide-GDP salvage from cobinamide II (4/6 steps found)
adenosylcobinamide-GDP salvage from assorted adenosylcobamides (1/2 steps found)
adenosylcobalamin biosynthesis II (aerobic) (17/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (16/36 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.156 or 2.7.7.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>MPMX26_01613 Bifunctional adenosylcobalamin biosynthesis protein CobP (Acinetobacter radioresistens SK82)
MLQLILGGARSGKSRLAEKIALESGLNVIYIATAQPLDEEMQERILHHQESRPREWQVIE
EPLYLSEKLQEIDAQNQLILIDCLTLWMSNLLLQDASELLMSQCQKLLTILPNLKSEIIL
VSNETGLGVVPMGNISRKFIDESGRLHQQIGQIVQKVVFCVAGFPIILKEEK