Protein Info for MPMX26_01600 in Acinetobacter radioresistens SK82

Annotation: Caffeyl-CoA reductase-Etf complex subunit CarC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF02771: Acyl-CoA_dh_N" amino acids 6 to 117 (112 residues), 105.8 bits, see alignment E=4.5e-34 PF02770: Acyl-CoA_dh_M" amino acids 121 to 217 (97 residues), 96.4 bits, see alignment E=2.4e-31 PF00441: Acyl-CoA_dh_1" amino acids 231 to 378 (148 residues), 165.5 bits, see alignment E=2.3e-52 PF22924: ACOX_C_alpha1" amino acids 243 to 376 (134 residues), 30.3 bits, see alignment E=8.6e-11 PF08028: Acyl-CoA_dh_2" amino acids 246 to 366 (121 residues), 85 bits, see alignment E=1.5e-27

Best Hits

Swiss-Prot: 40% identical to ACDB_BACSU: Acyl-CoA dehydrogenase (mmgC) from Bacillus subtilis (strain 168)

KEGG orthology group: K06446, acyl-CoA dehydrogenase [EC: 1.3.99.-] (inferred from 88% identity to abb:ABBFA_002144)

MetaCyc: 62% identical to medium-chain acyl-CoA dehydrogenase (Cupriavidus necator H16)
RXN-22997 [EC: 1.3.8.7]

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7, 1.3.99.-, 1.3.99.2

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.- or 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>MPMX26_01600 Caffeyl-CoA reductase-Etf complex subunit CarC (Acinetobacter radioresistens SK82)
MVRDQETLDQLLDMLRQFVEGVLIPRENEVAETDEIPADIVQQMRELGLFGLTIPEEYEG
LGLTMEEEVRVAFELGRTSPAFRSLIGTNNGIGASGLIIDGTEEQKQYYLPRFAKGEIIG
SFCLTEPESGSDAASLRTTAVKDDDFYILNGTKRFITNAPHAGAFTVMARTNSEIKGARG
ISAFIIDSKTPGISLGKRDQKMGQKGAHTCDVIFENCRVPASALIGGVEGVGFKTAMKVL
DKGRLHIAALSVGAAVRMLDDALRYAVERKQFGQPIASFQLIQAMLADSKAEIYAAKCMV
LDAARRRDQGENISTEASCSKMFATEMCGRVADRCVQIHGGAGYISEYSIERFYRDVRLF
RLYEGTTQIQQIIIARNMIREMTQ