Protein Info for MPMX26_01593 in Acinetobacter radioresistens SK82

Annotation: HTH-type transcriptional regulator TsaQ1/TsaQ2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF09339: HTH_IclR" amino acids 38 to 89 (52 residues), 59.9 bits, see alignment 1.6e-20 PF01614: IclR_C" amino acids 106 to 269 (164 residues), 70.2 bits, see alignment E=1.8e-23

Best Hits

KEGG orthology group: None (inferred from 87% identity to aby:ABAYE2308)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>MPMX26_01593 HTH-type transcriptional regulator TsaQ1/TsaQ2 (Acinetobacter radioresistens SK82)
MSESTRVEKTEKITNLDEIRLDPISHIHRENNPQFIASLARGLELLRCFSAHKQVLGNQE
LAKMTGLPKPTIARITNTLVSLGYLKQLPNSTKYMLDIGVLSLGYSALSNISIRNTAHPL
MEEMSKYAQAPVAMATRDRLNMIYIDVVQVESSLNMRRPIGSTLPIYSSSMGRACLAATP
EHERNFLMDALAKKNPENWPSIKRSLERAFRDYQDYGYCLSLGEWHKEVNSVAVPLVSSQ
HGLYVFNCGAPSFQLSPERLEDEIGPRLIHMVHNIQDSLNEIM