Protein Info for MPMX26_01581 in Acinetobacter radioresistens SK82

Annotation: Exodeoxyribonuclease 7 large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 PF13742: tRNA_anti_2" amino acids 6 to 113 (108 residues), 46.6 bits, see alignment E=3.3e-16 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 8 to 414 (407 residues), 254.5 bits, see alignment E=1e-79 PF02601: Exonuc_VII_L" amino acids 137 to 332 (196 residues), 134.1 bits, see alignment E=8.1e-43 amino acids 285 to 413 (129 residues), 51.7 bits, see alignment E=9.9e-18

Best Hits

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 69% identity to abc:ACICU_01203)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>MPMX26_01581 Exodeoxyribonuclease 7 large subunit (Acinetobacter radioresistens SK82)
MADPQLSLSEYLSGVQEIIQLTFDESVWVRAEIRNLNIKGGHYYLELAEKEQQSDKVIAS
CRATIWKFSAANIVLKFERESGIELSKDLNVLIKVKARFDPQYGFSVNIEDIDSSFTLGD
IARQYQQLVERLTQEGLIERNRQLVTPFDIQHVLVIAPQQAAGLGDFKKDADVLQKYGVC
NFIYQTATFQGQTAPKSIIEALRSALKHWANDFNYPPDLIVIIRGGGAVNDLAYLNDYEL
AALLCKRSVPVWVGIGHEKDRTILDEIAHRSFDTPSKVIAGIRNTISENVQQVQNTFQRI
KTLSQYQLMVYQSQNDQYMRLIRTLSHSQLSESAKTLDVLKDVVHCCAQQQVRQTKQHID
SLLKEILLQNPRHILNKGYAIVRYNGRAIRSVQQLNVIQNIQLELQDGKIQAEIVKGSQN
E