Protein Info for MPMX26_01571 in Acinetobacter radioresistens SK82

Annotation: Molybdenum cofactor guanylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF12804: NTP_transf_3" amino acids 20 to 171 (152 residues), 81.2 bits, see alignment E=5e-27

Best Hits

Swiss-Prot: 68% identical to MOBA_ACIBC: Molybdenum cofactor guanylyltransferase (mobA) from Acinetobacter baumannii (strain ACICU)

KEGG orthology group: K03752, molybdopterin-guanine dinucleotide biosynthesis protein A (inferred from 68% identity to acd:AOLE_07160)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>MPMX26_01571 Molybdenum cofactor guanylyltransferase (Acinetobacter radioresistens SK82)
MKKGSKRENNKTVYPRTDLVILAGGQARRMNGINKLLQKFDEQIQLIKIYQQLKPNIAQV
WINSHRDYSIYQKIIPNIYYYQDDETGFQGPLMGMKSAWSHVQSDYVLFVPCDVTYIPSK
VLLKLHVALAKNNLAEVAYVEINGKPLYPFCLVKRSSLVTLNLHIEQEQRSLKHCFSDLH
AQVACFKNHALFFHSINSLDELQQYQQLKFLH