Protein Info for MPMX26_01566 in Acinetobacter radioresistens SK82

Annotation: Molybdopterin molybdenumtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 PF03453: MoeA_N" amino acids 15 to 176 (162 residues), 122.6 bits, see alignment E=1.9e-39 TIGR00177: molybdenum cofactor synthesis domain" amino acids 186 to 324 (139 residues), 90.4 bits, see alignment E=5.3e-30 PF00994: MoCF_biosynth" amino acids 189 to 326 (138 residues), 98.3 bits, see alignment E=5e-32 PF03454: MoeA_C" amino acids 344 to 408 (65 residues), 43.1 bits, see alignment E=5.9e-15

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 60% identity to acd:AOLE_07190)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>MPMX26_01566 Molybdopterin molybdenumtransferase (Acinetobacter radioresistens SK82)
MNTISSRCGAEHGLISVDQALDRILQHVQPLDTEKLELQNALNRYLAENIYSSINLPLFS
QSAVDGYAICAKKAIEPESEFQLIGEIRAGQQVEVQLQAEQAVRIFTGAKIPSGTTTVAR
QEIVELINSSRIKIIENLKANIDIRDVGEEIVAGQLLANEGQQLSVGVIASLSMAGINTV
EVFQYPKVAIVISGDEVAESVEDFAAGKIFDANGPLIKAWFQQAGQQVEIFHIADTKEAV
QALIQKLLSSYDLILTTGGVSVGDYDFIRPVALESGFEQIFWKVKQKPGKPIFFAYLQRN
DKSACYLLGLPGNPAAVYVGMQVYTSTLLNVLQGQKNQPSWFNAVLSHDLKMDARERFLR
MYASFDDSVLTVKSLSRQQSHMLSNLMQANCLVRVPAERNLSQGDMVQGLFIQ