Protein Info for MPMX26_01557 in Acinetobacter radioresistens SK82

Annotation: Putative 1,2-phenylacetyl-CoA epoxidase, subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF01883: FeS_assembly_P" amino acids 11 to 71 (61 residues), 50 bits, see alignment E=3e-17 TIGR02159: phenylacetate-CoA oxygenase, PaaJ subunit" amino acids 18 to 166 (149 residues), 195 bits, see alignment E=3.8e-62 PF23451: Zn_ribbon_PaaD" amino acids 119 to 164 (46 residues), 71.4 bits, see alignment E=4e-24

Best Hits

Swiss-Prot: 57% identical to PAAD_ECOLI: Putative 1,2-phenylacetyl-CoA epoxidase, subunit D (paaD) from Escherichia coli (strain K12)

KEGG orthology group: K02612, phenylacetic acid degradation protein (inferred from 75% identity to acd:AOLE_12920)

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaJ subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>MPMX26_01557 Putative 1,2-phenylacetyl-CoA epoxidase, subunit D (Acinetobacter radioresistens SK82)
MELIKHCLDECWETLKQVADPEIPVLSVVDLGMIRGVELNEEDQIIVRLTPTYSGCPATD
LLKAEITQAFTVQGLVPVQVVVDLSEVWTTDWMSESGKQKLQQYGIAPPQGEAHSCGTHV
ALSDGIKCPRCHSQHTKLLSEFSSTACKALYRCQQCLEPFDYFKCI