Protein Info for MPMX26_01554 in Acinetobacter radioresistens SK82

Annotation: Phenylacetate-coenzyme A ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 TIGR02155: phenylacetate-CoA ligase" amino acids 10 to 427 (418 residues), 691.3 bits, see alignment E=1.8e-212 PF00501: AMP-binding" amino acids 82 to 287 (206 residues), 71.2 bits, see alignment E=7.4e-24 PF14535: AMP-binding_C_2" amino acids 334 to 427 (94 residues), 90.6 bits, see alignment E=6.2e-30

Best Hits

Swiss-Prot: 67% identical to PAAK_ECOLI: Phenylacetate-coenzyme A ligase (paaK) from Escherichia coli (strain K12)

KEGG orthology group: K01912, phenylacetate-CoA ligase [EC: 6.2.1.30] (inferred from 74% identity to aby:ABAYE2366)

MetaCyc: 67% identical to phenylacetate-CoA ligase (aerobic) (Aromatoleum evansii)
Phenylacetate--CoA ligase. [EC: 6.2.1.30]

Predicted SEED Role

"Phenylacetate-coenzyme A ligase (EC 6.2.1.30) PaaF" (EC 6.2.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>MPMX26_01554 Phenylacetate-coenzyme A ligase (Acinetobacter radioresistens SK82)
MNNNTMEYIETVSTDELRKVQLERIKKTLVHAYQNSPVYRKKFDDAGVHPEDFQHLEDLA
KFPFTTKQDLRDHYPFGMFAVPQEKIVRVHASSGTTGQPTVVGYTQNDIHTWADLVARSL
RAAGLSNQDIIQVSYGYGLFTGGLGAHYGVERLGATVIPMSGGQTERQAQLIHDFKPTAL
MVTPSYCLNIIECLEKKFNTAKNTSIKTGIFGAEPWTNEMRREIEERLNIDALDIYGLSE
VMGPGVAMECLESKDGPTIWEDHFYPEIIDPETGEVLPDGELGELVFTTITKEGMPVIRY
RTRDLTRLLPGTVRPMRRMDKIVGRSDDMMIIRGVNVFPSQIEEQILHIPQLIPNYQIHI
CKHGHLDSLHIRAEMRKEINDMMAHQLSQQLISQIKIMVGITVSVEIVTEGTLPRSEGKA
QRVFDIRQSA