Protein Info for MPMX26_01545 in Acinetobacter radioresistens SK82

Annotation: Fatty acid oxidation complex subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 105 to 122 (18 residues), see Phobius details PF00378: ECH_1" amino acids 14 to 246 (233 residues), 123.9 bits, see alignment E=7.5e-40 PF16113: ECH_2" amino acids 16 to 330 (315 residues), 334.8 bits, see alignment E=7.6e-104

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 76% identity to abm:ABSDF0127)

Predicted SEED Role

"3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 3.1.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.4, 4.2.1.17

Use Curated BLAST to search for 3.1.2.4 or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>MPMX26_01545 Fatty acid oxidation complex subunit alpha (Acinetobacter radioresistens SK82)
MDMEKHLIIEQQGVLGIISLNRVANLNALSIEMIHQIHMQFETWQQDHSIQAILIKSNSP
KAFCAGGDIRYLYDNYKNQTEAHKAYFSAEYDMLNMIRDYQKPVIVILDGYVLGGGFGLA
QACHIIVSSEKSRFAMPETAIGFFPDVAATHFLSRLDDIGVYMAITGEQISSSDALYLDL
IDYHVPGEKLQALQNELAHSSSLNKEKIQQMVRKYITRPAESDLSSRSENIRKHFGFKNL
QDIEQSLENEQDEQYKAWTNKILITLQQRSLIAKQTSLKLQHLGRSLSLQQCMQIERDLQ
DIWFEHGDFIEGVRALIVDKDKQPQWKKENPELEQILERLG