Protein Info for MPMX26_01544 in Acinetobacter radioresistens SK82

Annotation: Fosfomycin resistance protein AbaF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details amino acids 405 to 425 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 24 to 229 (206 residues), 85.3 bits, see alignment E=4.5e-28 amino acids 256 to 437 (182 residues), 23.3 bits, see alignment E=2.9e-09 PF07690: MFS_1" amino acids 65 to 390 (326 residues), 110.3 bits, see alignment E=1e-35

Best Hits

KEGG orthology group: None (inferred from 88% identity to aby:ABAYE3762)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>MPMX26_01544 Fosfomycin resistance protein AbaF (Acinetobacter radioresistens SK82)
MQTIHGNGSHSKKSSHRLAGISSMVGTTIEWYDFFIYGAAAALIFNKLFFPNLDPLTGVL
AAFATYAVGFIGRPLGGIVFGHFGDKVGRKSMLLVTLMLMGIPTVIIGLLPTFESIGYWA
TVCLIILRFIQGMAMGGEWGGAVLMAVEHAPEGGKGFWGSLPQASTGGGLMLASVALGLV
SLLPEEALFSWGWRLPFLASIVLLAVGWYIRVKVPESPDFEKIKEKAKEVKVPALQVFKN
HPKQLITIILSRAAENAWFYLASTFALAYTTTQLNIPRQDILFATICGAAVIMVMTPLCG
HLSDKVGQRNMFRFGLCMLALYSYPFFAMLNTKDPVLVWTAIVLAIGVIFPIMYAPQSQL
FARQFPAEIRYSGISISVQFAGVLGGGLAPLIATKLLSIGEGSPHLIIMYIISFAVLAII
ASSFLKPDQKLKPTETFTQKEIKTL