Protein Info for MPMX26_01491 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 169 to 192 (24 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details PF06912: DUF1275" amino acids 14 to 210 (197 residues), 115.2 bits, see alignment E=1.7e-37

Best Hits

KEGG orthology group: None (inferred from 79% identity to abb:ABBFA_001940)

Predicted SEED Role

"conserved hypothetical protein; putative membrane protein."

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>MPMX26_01491 hypothetical protein (Acinetobacter radioresistens SK82)
MPFQKLPAWIQIGAFLLAINAGMINVLGLVTVLHQSVSHMTGNISMLAMSLINWEPSSVL
YLILVVLCYVTGSFYSGLILGNSHFQLGRRYGLPLSLVALFIFLCWILLPYFPRYALLWA
CVAMGVQNAMVSHYKGTIIRTTHLSGVLTDLGLALGYCLRGLSVGKRRIILHLLILFGFL
IGGIVASLIYPYLKLQSFLVPAVLSLSLSIIYWSIYFRHKSTQHSSWE