Protein Info for MPMX26_01323 in Acinetobacter radioresistens SK82

Annotation: Chaperone protein HscA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 619 TIGR01991: Fe-S protein assembly chaperone HscA" amino acids 21 to 614 (594 residues), 874.2 bits, see alignment E=2.3e-267 PF00012: HSP70" amino acids 21 to 594 (574 residues), 577.1 bits, see alignment E=3.6e-177 PF06723: MreB_Mbl" amino acids 124 to 376 (253 residues), 64.7 bits, see alignment E=6.9e-22

Best Hits

Swiss-Prot: 85% identical to HSCA_ACIBT: Chaperone protein HscA homolog (hscA) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K04044, molecular chaperone HscA (inferred from 85% identity to acd:AOLE_10605)

Predicted SEED Role

"Chaperone protein HscA" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (619 amino acids)

>MPMX26_01323 Chaperone protein HscA (Acinetobacter radioresistens SK82)
MALLQIAEPGQSSAPHEHRIAIGIDLGTTHSLVATVLSGKTKVLNDEQGRVLLPSIVHYG
LDSTHYGEDAKPFVTSDSKNTIISVKRFMGRSQTDIKFQHPYTLLGEASQMPAFETVQGR
KTPVEISADILKQLKSRAEVSLQNPVNGAVITVPAYFDEAQRQATRDAAQLAGLNVLRLL
NEPTAAAVAYGLDQATNLATDRNYVIYDLGGGTFDVSILRFSQGVFEVLATGGHTALGGD
DLDRLIVKWAKKELNIETFNNQEYAQVLFAARRAKEALTNADSTMLTILDHTLQLDRPTF
ESIIKVALDKTISVCKRVLRDAKLELSDIQNVVLVGGSTRSYAVQRAVAEVFNQEPLCTI
NPDEVVAIGAAITANQLIGNTQEGSLLLDVTPLSLGLETMGGLVERLIGRNTPIPVARRQ
EFTTYQDGQTAMLIHVVQGERDLVEHCRSLGRFVLHGIPPMTAGQARIEVTFQVDADGLL
TVSAKETTSGVNAKIDIKPSYGLSEADTERLLLEGFKYAEEDKDLRHLQETKVEAQRELE
ALEQALKVDAELLSKDQLTELQAAKNALKGQLEQNDIHSIEQAVKQLKVHSDTFAALRMN
QHIDHALKGTKLDDWSNSN