Protein Info for MPMX26_01316 in Acinetobacter radioresistens SK82

Annotation: Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 TIGR01935: RraA family" amino acids 7 to 162 (156 residues), 202.8 bits, see alignment E=1.2e-64 PF03737: RraA-like" amino acids 7 to 161 (155 residues), 159.5 bits, see alignment E=3.7e-51

Best Hits

Swiss-Prot: 81% identical to RRAAH_ACIAD: Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (ACIAD1391) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K02553, regulator of ribonuclease activity A (inferred from 90% identity to abn:AB57_1844)

Predicted SEED Role

"Ribonuclease E inhibitor RraA" in subsystem RNA processing and degradation, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>MPMX26_01316 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Acinetobacter radioresistens SK82)
MNTEFVTCDLLDDNPDKELQVMCPSIDGKYFKSYGLRKTFGGQVVTVKCFEDNSRVKELL
ATDGTGKVLVVDGGASMRCALMGDMIAESAVKNHWNGVIIYGCVRDVDAIAELDLGVHAL
AAIPQKSNRKGIGEVDITLYFGGVTIHAGDYIYADNNGIVISKEKLVEA