Protein Info for MPMX26_01304 in Acinetobacter radioresistens SK82

Annotation: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 68 to 89 (22 residues), see Phobius details TIGR01750: beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ" amino acids 17 to 154 (138 residues), 185 bits, see alignment E=3.2e-59 PF07977: FabA" amino acids 26 to 150 (125 residues), 107.5 bits, see alignment E=2.2e-35

Best Hits

Swiss-Prot: 87% identical to FABZ_ACIBT: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (fabZ) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K02372, 3R-hydroxymyristoyl ACP dehydrase [EC: 4.2.1.-] (inferred from 85% identity to acd:AOLE_07355)

MetaCyc: 55% identical to beta-hydroxyacyl-[acyl carrier protein] dehydratase (Bacillus subtilis subtilis 168)
3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase. [EC: 4.2.1.59]

Predicted SEED Role

"3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)" (EC 4.2.1.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.- or 4.2.1.59

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>MPMX26_01304 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (Acinetobacter radioresistens SK82)
MMTESKIPAFAVPELPMHIQTIREYLPHRYPFLLVDRITEVTENGIVGYKNVSINEEFLQ
GHFPNYPLMPGVLIVEALAQVSGILGFIMNEQKPSEGSLFLFAGAEKVRFKKQVVAGDQL
VLKSELVMQRRGIYKYQCTASVDGIVATTAEIMVSHQQV