Protein Info for MPMX26_01304 in Acinetobacter radioresistens SK82
Annotation: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 87% identical to FABZ_ACIBT: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (fabZ) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
KEGG orthology group: K02372, 3R-hydroxymyristoyl ACP dehydrase [EC: 4.2.1.-] (inferred from 85% identity to acd:AOLE_07355)MetaCyc: 55% identical to beta-hydroxyacyl-[acyl carrier protein] dehydratase (Bacillus subtilis subtilis 168)
3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase. [EC: 4.2.1.59]
Predicted SEED Role
"3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)" (EC 4.2.1.59)
MetaCyc Pathways
- superpathway of fatty acids biosynthesis (E. coli) (47/53 steps found)
- superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
- oleate biosynthesis IV (anaerobic) (13/14 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
- biotin biosynthesis I (13/15 steps found)
- superpathway of unsaturated fatty acids biosynthesis (E. coli) (16/20 steps found)
- palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
- fatty acid elongation -- saturated (5/5 steps found)
- gondoate biosynthesis (anaerobic) (4/4 steps found)
- 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
- (5Z)-dodecenoate biosynthesis I (5/6 steps found)
- stearate biosynthesis II (bacteria and plants) (5/6 steps found)
- 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
- octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
- palmitate biosynthesis III (21/29 steps found)
- (5Z)-dodecenoate biosynthesis II (4/6 steps found)
- stearate biosynthesis IV (4/6 steps found)
- cis-vaccenate biosynthesis (3/5 steps found)
- tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
- 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
- streptorubin B biosynthesis (20/34 steps found)
- anteiso-branched-chain fatty acid biosynthesis (19/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (19/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (19/34 steps found)
- mycolate biosynthesis (22/205 steps found)
- superpathway of mycolate biosynthesis (23/239 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Fatty acid biosynthesis
- Limonene and pinene degradation
- Nucleotide sugars metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Porphyrin and chlorophyll metabolism
- Tyrosine metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.1.- or 4.2.1.59
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (159 amino acids)
>MPMX26_01304 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (Acinetobacter radioresistens SK82) MMTESKIPAFAVPELPMHIQTIREYLPHRYPFLLVDRITEVTENGIVGYKNVSINEEFLQ GHFPNYPLMPGVLIVEALAQVSGILGFIMNEQKPSEGSLFLFAGAEKVRFKKQVVAGDQL VLKSELVMQRRGIYKYQCTASVDGIVATTAEIMVSHQQV