Protein Info for MPMX26_01296 in Acinetobacter radioresistens SK82

Annotation: Ribosome-recycling factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 TIGR00496: ribosome recycling factor" amino acids 10 to 184 (175 residues), 217.4 bits, see alignment E=5.2e-69 PF01765: RRF" amino acids 21 to 182 (162 residues), 212.8 bits, see alignment E=1.4e-67

Best Hits

Swiss-Prot: 95% identical to RRF_ACIAD: Ribosome-recycling factor (frr) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K02838, ribosome recycling factor (inferred from 94% identity to abm:ABSDF1681)

Predicted SEED Role

"Ribosome recycling factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>MPMX26_01296 Ribosome-recycling factor (Acinetobacter radioresistens SK82)
MINDLKKDSEQRMQKSLESLEQGFAKVRTGRAHPSILNGVMVPYYGSDVPLNQVANVGVE
DSRTLVVQPFERTMVSAIDKAIRESDLGLNPITADAIRVPMPALTEETRRDMQKVARTEA
ENAKVAIRNIRRDVLGDIKALLKEKEISEDDERRAGEEIQKITDKYVAEVDKRLAAKEAE
LMKV