Protein Info for MPMX26_01284 in Acinetobacter radioresistens SK82

Annotation: ATP-dependent Clp protease ATP-binding subunit ClpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 758 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 3 to 734 (732 residues), 1091 bits, see alignment E=0 PF02861: Clp_N" amino acids 13 to 62 (50 residues), 52.8 bits, see alignment 2.4e-17 PF00004: AAA" amino acids 211 to 323 (113 residues), 52.1 bits, see alignment E=6.1e-17 amino acids 491 to 612 (122 residues), 44.1 bits, see alignment E=1.8e-14 PF17871: AAA_lid_9" amino acids 351 to 451 (101 residues), 96.5 bits, see alignment E=5.5e-31 PF07724: AAA_2" amino acids 485 to 644 (160 residues), 204.3 bits, see alignment E=8.9e-64 PF07728: AAA_5" amino acids 490 to 607 (118 residues), 47.7 bits, see alignment E=1.1e-15 PF10431: ClpB_D2-small" amino acids 655 to 733 (79 residues), 87.1 bits, see alignment E=4.4e-28

Best Hits

Swiss-Prot: 58% identical to CLPA_RHOBL: ClpA homolog protein from Rhodobacter blasticus

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 92% identity to aby:ABAYE1656)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (758 amino acids)

>MPMX26_01284 ATP-dependent Clp protease ATP-binding subunit ClpA (Acinetobacter radioresistens SK82)
MLSRQLEVSLRLAVSMARQKRHEFLTVEHLLLALLDNDSAVNALKACGADIVLLRKELEE
YVEQHTPKLGENSDQAPHPTESFDRILQRAIFHVQSSGGDRTVEGADVLVAMYSERDSFA
VYLLKRHQINRLTLTQYLSHGTRKDEVHMEEEAEDIEGEATSSANAGPLELYTTNLNIEA
QKGKTDPLIGREKEIERAAQILCRRRKNNPLLVGDPGVGKTSIAEGLAWLIVNNKAPKPL
ANAEIYSLDIGALVAGTKYRGDFEKRLKQLLNALKKKPEAVLFIDEIHMIIGAGSSMGST
MDASNLIKPALANGTLRCIGSTTFQEYRQVFEKDHALSRRFQKIDVNEPTISESIDILRG
LKPKFEDFHHVEYEDSALVAAVELSSKFINDRFLPDKAIDVIDEAGAQRRLKADADNTLI
TVENIEDIISKIARIPPKTVSKDDKTVLSHLERDLKRVVFGQDEAITALASAIKLSRAGL
KSPDKPVGSFVFAGPTGVGKTEVTKQLAKILGLELVRFDMSEYMERHTVSRLIGAPPGYV
GYDQGGLLTDAIHKNPHCVLLLDEIEKAHPDVFNLLLQVMDHGSLTDNNGRKSDFRNVIL
VMTTNIGAESISRTSIGFVEQDNSNDNQEAMKKAFSPEFRNRLDGVIQFKPLPTTIIESV
VDKFLTELQAQLDEKKVVLEVDQSAREWLTEQGYDRLMGARPMQRLIQEHLKKPLAEMIL
FGELAEHGGNVAVSVKKENGQAVGLKLEVFEDQTAEPA