Protein Info for MPMX26_01276 in Acinetobacter radioresistens SK82

Annotation: Ktr system potassium uptake protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 290 to 332 (43 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 380 to 397 (18 residues), see Phobius details amino acids 408 to 431 (24 residues), see Phobius details PF02386: TrkH" amino acids 33 to 431 (399 residues), 203.8 bits, see alignment E=2e-64

Best Hits

Swiss-Prot: 42% identical to KTRB_BACSU: Ktr system potassium uptake protein B (ktrB) from Bacillus subtilis (strain 168)

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 74% identity to abb:ABBFA_001534)

Predicted SEED Role

"Potassium uptake protein, integral membrane component, KtrB" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>MPMX26_01276 Ktr system potassium uptake protein B (Acinetobacter radioresistens SK82)
MHFPNFRHLTQRTVNLSPPTLLALGFLSFILVGTLLLRLPISHHGHLSWMDALFTATSAV
TITGLSTISVHDSLTGFGQTVLLLLIQSGGLGFMTFAILAALSLSPKVRLRQQMMAQTAT
GQTNLSKVTFVAKGVFFYTLFFELIGTVILTVLFTPEYGFPTSLHYAIFYSISSFNNAGF
SIFGDSLMSFEGQYLVYLVISLLYIIGGIGFIVLMDIKRSKSWSKLSANSKLVLSSIAII
NLLAFIVIWMLEATNYQTLGQLNLGEQAVHAWFQATAPRSSGLNTIDTGSMTSTSTLVVM
LLMFIGGGSLSTAGGIKVGTFVVLLLSVISFLRRNEEVRAFNHSISQETTVKALAVAMIT
CILIFGGFFLILLLEPRQNFLDLLFEIVSAACTVGLSRGITSELSPGSLMILIFLMYAGR
LGPLTLAYLIATPKKSRLKHPPTDIQIG