Protein Info for MPMX26_01269 in Acinetobacter radioresistens SK82

Annotation: Putative metabolite transport protein YjhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details amino acids 406 to 427 (22 residues), see Phobius details PF07690: MFS_1" amino acids 39 to 294 (256 residues), 136.7 bits, see alignment E=9.5e-44 amino acids 293 to 432 (140 residues), 66 bits, see alignment E=3.1e-22 PF00083: Sugar_tr" amino acids 65 to 418 (354 residues), 115.2 bits, see alignment E=3.7e-37

Best Hits

KEGG orthology group: K08196, MFS transporter, AAHS family, cis,cis-muconate transporter (inferred from 90% identity to acd:AOLE_16160)

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>MPMX26_01269 Putative metabolite transport protein YjhB (Acinetobacter radioresistens SK82)
MNNEVQVAIKPIKGNLPSNLGTYEKIGPHTWKFALLFTYFAMVVDGIDIMLLSYSLTSLR
ADFGLSAFQAGALGSASLAGMGVGGVLGGWACDKFGRVRTIAHSVTFFSVATCLLGFTQT
FEQFMVLRFIGALGIGALYMACNTLMAEYVPTTYRTTVLGTLQTGQTVGYIVATLLAGSI
IPEHGWRVLFFITVIPAFINIFLQRFVPEPKSWQLNKIAVLQGTAQVQDQEVAPKSGSIY
KQIFRNFKHRKMFLLWMTTAFFLQFGYYGINNWMPSYLETEVHMNFKNLTSYMVGSYTAM
ILGKILAGFLADKFNRRSVFVFGTIASAIFLPVIIFFNTPDNILYLLITFGFLYGIPYGV
NATYMAESFSTDVRGTAIGGAYNIGRVGAAIAPATIGFLASGGTFTMAFIVMGAAYFIAG
VLPGLFIRDRQYDPQQQ