Protein Info for MPMX26_01253 in Acinetobacter radioresistens SK82

Annotation: Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF02779: Transket_pyr" amino acids 5 to 191 (187 residues), 160.7 bits, see alignment E=2.9e-51 PF02780: Transketolase_C" amino acids 207 to 329 (123 residues), 140.9 bits, see alignment E=2.1e-45

Best Hits

Swiss-Prot: 60% identical to ACOB_CUPNH: Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta (acoB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 96% identity to acd:AOLE_10255)

MetaCyc: 58% identical to acetoin:DCPIP oxidoreductase beta subunit (Syntrophotalea carbinolica DSM 2380)
RXN-9718 [EC: 2.3.1.190]

Predicted SEED Role

"Acetoin dehydrogenase E1 component beta-subunit (EC 1.2.4.-)" in subsystem Acetoin, butanediol metabolism (EC 1.2.4.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.-, 1.2.4.1

Use Curated BLAST to search for 1.2.4.- or 1.2.4.1 or 2.3.1.190

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>MPMX26_01253 Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta (Acinetobacter radioresistens SK82)
MPNKSYRNAIKEAIELEMRRDPTVFVVGEDVRGGHGGKNTEDNALEGFGGVLGVTKGLWS
EFGSERVIDTPITESAIIGMAAGAAATGLRPVADLMFMDFYGVCHDMLYNQAAKFRYMFG
GKAKAPMVVRGMIGAGFSAAAQHSQSPYNVFAAVPGLKVVVPSSPYDVKGLLIQAIHDDD
PVVFCEHKLLYDIKGEVPDDAYTIPFGVANYTREGTDVTIIALSLMVHRANEVADKLAKE
GISVEVVDPRTISPLDEEGILESVASTGRVVIVDESAARCGFGHDIAALIAQKGFHYLKA
PIELVTPPHTPVPFSPVLEKEWIPSVERIEQAVRKTLEA