Protein Info for MPMX26_01246 in Acinetobacter radioresistens SK82

Annotation: Cell division protein ZapE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF03969: AFG1_ATPase" amino acids 16 to 369 (354 residues), 441.1 bits, see alignment E=1.5e-136

Best Hits

Swiss-Prot: 50% identical to ZAPE_ECO57: Cell division protein ZapE (zapE) from Escherichia coli O157:H7

KEGG orthology group: K06916, (no description) (inferred from 87% identity to acd:AOLE_10745)

Predicted SEED Role

"ATPase, AFG1 family" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>MPMX26_01246 Cell division protein ZapE (Acinetobacter radioresistens SK82)
MLELKSSHSTAFSPVSPAERYSQALSSGQFLPDEAQAQAVQELDRVWHELIHRYKASKKA
FRRFRRQTAPRGVYMWGGVGRGKTWLMDQFFESIPFRRKLRMHFHHFMQHVHRELNKLSG
QRNPLDLVADQIYKDAVIICFDEFFVSNVTDAMILSDLFQKLFQRGITLVATSNIAPDGL
YKNGIHRDRFLPTIEMVKKNCVVLNVDAGVDYRLRVLKQAQLFKAPLSHEAQQWIAQRFS
ALTQTQVQSQESIIINNRIVETIGHTEDVLWCEFSELCLKPRSPSDFIEIANIYNTVLVS
NVPHLTDQINDATRRFIYLVDEFYDRGVKLLLTSQDDIINIYQGEKLAFEIERTRSRLLE
MQSDEYLHSEHKQIHGAQ