Protein Info for MPMX26_01244 in Acinetobacter radioresistens SK82

Annotation: Baeyer-Villiger monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 15 to 214 (200 residues), 38 bits, see alignment E=3.4e-13 PF00743: FMO-like" amino acids 15 to 219 (205 residues), 78 bits, see alignment E=1.4e-25 PF00890: FAD_binding_2" amino acids 16 to 52 (37 residues), 21.4 bits, see alignment 3.3e-08 PF13738: Pyr_redox_3" amino acids 18 to 217 (200 residues), 67.4 bits, see alignment E=3.3e-22 PF13450: NAD_binding_8" amino acids 18 to 72 (55 residues), 38.4 bits, see alignment 3e-13

Best Hits

KEGG orthology group: None (inferred from 72% identity to acd:AOLE_10755)

Predicted SEED Role

"Cyclohexanone monooxygenase (EC 1.14.13.22)" (EC 1.14.13.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.22

Use Curated BLAST to search for 1.14.13.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>MPMX26_01244 Baeyer-Villiger monooxygenase (Acinetobacter radioresistens SK82)
MQKNNIEPVTGRRVKVAIIGAGFGGLAAAIRLLQQNIDDFIIIEKTGDVGGTWRENRYPG
AACDVQSHMYSLSFAPKTDWSKRYAEAPEIFEYIQNLTEKYQLRQYIQFNTEVTGTFYNE
QLNTWHIEIDGQENIEAQFVIFASGPLHVPQIPKIKGIEKFNGKIFHSSQWDHQYDLTGK
TVASIGTGGSAIQYIPEIASQVKQLYVMQRSAAWVIPRDERKYGQLEKNLFAQQEWFRKL
HRIRLYWSNESRVIPIVQPFAMRYVEKLGRAFIRLQVKDKTIAKKLTPDYIMGCKRILVS
NKYYPTFNRSNVELVTDKIREITEDSIITQDGQTRRIDCLIYGTGFITDPRVYLKNFPCI
GQHNQSLAKAWEDGAESYYGVSTKGFPNLFQLLGPNTVLAHNSVLFMIESQIEHILQLIQ
LVEKTHTQAVVVKAEVQDQFNHRVQDMLKGTVWQSGCTSWYQQNGGKNFSLWPTYTWRYW
LETRKVNPADYHFLGNSTISRAA