Protein Info for MPMX26_01242 in Acinetobacter radioresistens SK82

Annotation: Orotidine 5'-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00215: OMPdecase" amino acids 2 to 222 (221 residues), 218.3 bits, see alignment E=6.5e-69 TIGR01740: orotidine 5'-phosphate decarboxylase" amino acids 4 to 222 (219 residues), 197.4 bits, see alignment E=1.2e-62

Best Hits

Swiss-Prot: 84% identical to PYRF_ACIB3: Orotidine 5'-phosphate decarboxylase (pyrF) from Acinetobacter baumannii (strain AB307-0294)

KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 84% identity to abb:ABBFA_001901)

Predicted SEED Role

"Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23)" in subsystem De Novo Pyrimidine Synthesis (EC 4.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>MPMX26_01242 Orotidine 5'-phosphate decarboxylase (Acinetobacter radioresistens SK82)
MSIIVALDAKSQYDALKIADELDPSLCRVKVGKELFTHEGPSIVKTLQNKGFEVFLDLKF
HDIPNTTAQAVCAAADLGVWMVNVHASGGRKMMETCVERLKAGQYPTQLIAVTVLTSQTR
DDLRDIGLDIEPFEQVKRLAKLTQESGLDGVVCSAQEAPLLRKELGQDFALVTPGIRPAS
SSADDQKRIVTPKQAMLDGSTHLVIGRPITQSTDPAGALKEILASL