Protein Info for MPMX26_01241 in Acinetobacter radioresistens SK82

Annotation: HTH-type transcriptional regulator SutR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF13560: HTH_31" amino acids 12 to 61 (50 residues), 40.7 bits, see alignment E=3.7e-14 PF01381: HTH_3" amino acids 12 to 66 (55 residues), 55 bits, see alignment E=1e-18 PF13443: HTH_26" amino acids 13 to 70 (58 residues), 32.3 bits, see alignment E=1.4e-11

Best Hits

KEGG orthology group: None (inferred from 88% identity to aci:ACIAD2342)

Predicted SEED Role

"Putative DNA-binding protein in cluster with Type I restriction-modification system" in subsystem Restriction-Modification System

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>MPMX26_01241 HTH-type transcriptional regulator SutR (Acinetobacter radioresistens SK82)
MTLPIEIVAKGLQRERQKAGLSLTEVARRAGIAKSTLSQLEAAQGNPSLETLWALCVALD
IPFAKLMEANTAQTQVIRFGEGPSVSSEIAHYQAILLANCPTGARRDVYILTTHPGEPRC
SQPHPIGSIEHIIIMKGKAKVGLVSEPIVLNEGDYICYPADQAHIFEALEHDTRAILISE
QR