Protein Info for MPMX26_01216 in Acinetobacter radioresistens SK82

Annotation: putative chromosome-partitioning protein ParB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 37 to 211 (175 residues), 193.8 bits, see alignment E=1.2e-61 PF02195: ParBc" amino acids 40 to 131 (92 residues), 102.9 bits, see alignment E=1.3e-33 PF17762: HTH_ParB" amino acids 181 to 231 (51 residues), 67.2 bits, see alignment 1.3e-22 PF23552: ParB_dimer" amino acids 245 to 290 (46 residues), 71.7 bits, see alignment 4e-24

Best Hits

Swiss-Prot: 53% identical to PARB_COXBU: Probable chromosome-partitioning protein ParB (parB) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 86% identity to abb:ABBFA_001924)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>MPMX26_01216 putative chromosome-partitioning protein ParB (Acinetobacter radioresistens SK82)
MTTKKRGLAKGRGLDALLGSIQKEKLQLEAQSLDHGQLKQIDVHLLKRGEYQPRRFIEEK
DLQELAASIEKHGVMQPIVIRPVDDEKRPYEIIAGERRWRAAQLAGLTEVPAIVRDLNDQ
VAIALALIENIQRQDLNPIDQAIALQRFHDEFGLSHQEIAETVGKARTTVSNLLRLLSLA
EPVKDFMQQGLLDMGHARAILTLKSKDQLKAADTVIEKSLSVRQTEQLVREWNTPKQEKN
KTSMSADLEQLTQRLSERFSADVKIDYNKQGKGKLVIHYHSLDELDGILNICLAD