Protein Info for MPMX26_01175 in Acinetobacter radioresistens SK82

Annotation: Release factor glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR00536: methyltransferase, HemK family" amino acids 17 to 271 (255 residues), 223.7 bits, see alignment E=2.5e-70 PF17827: PrmC_N" amino acids 17 to 70 (54 residues), 48.6 bits, see alignment E=3.4e-16 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 23 to 269 (247 residues), 274.9 bits, see alignment E=6.3e-86 PF05175: MTS" amino acids 92 to 192 (101 residues), 54.1 bits, see alignment E=5.4e-18 PF13847: Methyltransf_31" amino acids 107 to 242 (136 residues), 45.9 bits, see alignment E=1.7e-15 PF08241: Methyltransf_11" amino acids 111 to 183 (73 residues), 26.1 bits, see alignment E=3.8e-09 PF13649: Methyltransf_25" amino acids 111 to 196 (86 residues), 37.1 bits, see alignment E=1.5e-12

Best Hits

Swiss-Prot: 47% identical to PRMC_ALIF1: Release factor glutamine methyltransferase (prmC) from Aliivibrio fischeri (strain ATCC 700601 / ES114)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 66% identity to abm:ABSDF1587)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>MPMX26_01175 Release factor glutamine methyltransferase (Acinetobacter radioresistens SK82)
MKLSEALTVRGIPDSYERQENIWLLEHILNIKMFEFRFRQDKELTAEQQHAYLAALARLE
AGEPLAYILGSQPFWTLDLKVTRDTLVPRPDTEVLVETVLTLELPEETKMVDLGTGTGAI
ALALASEKPYWSVLATDVYMPTLTVARENADKHGLQQVEFACGAWFAALNQLPEPMFDLI
VSNPPYIDAEDRHMKDLATEPVRALVALKQGLADLETIIEQGKSWLRPKGWIVLEHGYEQ
AEAVRSFFEHKGFQSVRTVKDYNGNDRVTLGQLI