Protein Info for MPMX26_01162 in Acinetobacter radioresistens SK82

Annotation: Cytochrome bo(3) ubiquinol oxidase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 11 to 236 (226 residues), 328.1 bits, see alignment E=1.2e-102 PF06481: COX_ARM" amino acids 297 to 323 (27 residues), 37.7 bits, see alignment (E = 1.5e-13)

Best Hits

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 78% identity to aci:ACIAD2425)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>MPMX26_01162 Cytochrome bo(3) ubiquinol oxidase subunit 2 (Acinetobacter radioresistens SK82)
MRQTILAVLSLSTLAVLLTGCGGDLVLLNSKGPVAAGQSNLMMTAIYLMLLVVIPSIIMA
LWFGWKYHASNKDADYKPTWAHSTTIEVVVWGIPVIIIGILAWLTWVGSHKYDPYRPIES
EQAPLNVQVIAEQFKWVFIYPEQNIATVNELRFPVDTPVSFRLTSNFTMNSFFIPQLAGQ
IYAMAGMQTHLNVLAEETGVYRGFSANYSGYGFSQMRFLAYSVTRPEFDQWVAAVKAGNG
TSVNPEAIQKGILDQAEFATLRDGNRAKHQIESIVARAVTPEEKAEAAKLEAEGTYPTKP
HPVTYYSSVEPKLFESVINKYMSNYHGADHSAQAGAEHAGASHANVEHATASVEE